Mintel

Mintel

Company

Legal NameMintel GmbH
HeadquartersDüsseldorf, Germany
Websitehttps://mintel.com

About Mintel

Mintel is the world's leading market intelligence agency. With offices around the world we take a global view on what is happening in the space of FMCG/CPG innovation. We offer our clients a unique perspective on the future of the consumer landscape and a clear roadmap to navigate it with. The Client Services Executive will enable Mintel's Account Management team to deliver more value to our clients by providing additional support to their subscription as to help achieve increasing renewal rates and maximum growth within each account. The primary responsibility of this role is to provide help desk support, client webex / phone training, usage analysis and topline analytical support to our existing client base. In partnership with Account Management, you will leverage your analytical skills to help present value and insights to our clients. You will be responsible with providing timely and thorough response to ad-hoc client requests using the appropriate Mintel tools and services. This position will ultimately assist our Account Managers to deepen and expand the core relationships that Mintel has within every client account. Overall Responsibilities Include: Help-desk support to clients for India and Sri Lanka Coordinate new client set up and renewal admin Support account management team with proactive servicing emails for India Salesforce management, i.e. drive commercial team to document all sales, renewals, upgrades, servicing, consultancy etc updates in SalesForce.com Keep track of renewal, upgrade, new business and usage discussions through meeting notes. Basic client admin – Service plan management, creating summary of activity documents, illegal usage, analyst hour tracking etc. Synthesize data from internal products and services while providing analysis and insightful commentary in response to specific client requests First point of contact for all commercial related incoming calls to India Office Provide objective-based training to clients via web-based tools Strategize with Account Managers in regards to renewal and upgrade opportunities for clients Collaborate with Account Managers on all key initiatives and provide support as appropriate Engage with clients to gather feedback and understand business objectives Continue to Develop and maintain domain expertise in the Consumer Packaged Goods industry Put together comprehensive partnership reviews for our clients, demonstrating the value and ROI of Mintel's services Handle ad-hoc commercial administrative request Skills Desired: Minimum Bachelor's Degree is required 1-3 years client services experience in a corporate setting Advanced knowledge of Microsoft PowerPoint and Excel Excellent English communication skills – verbal and written Ambitious, gregarious and hardworking #LI-FT ------

Synonyms

mintelmintel gmbhmintel international groupmintel international group ltd

Technologies (from Job Ads)

microsoft excelmicrosoft officecelestiamicrosoft 365pythonawsmicrosoft dynamicsreact.jsreactosjirasqldevopsdjangogoogle chromejakarta slidejavascripttypescriptxulcode reviewdata managementlinuxmalwaremarket researchmicrosoft dynamics crmmicrosoft powerpointpair programmingpowershellscalabilityscrumapache http serverapache licensecornerstonedata analysisdataversedockerelasticsearchgitlampmysqlnetsuite

Hiring Locations (10 of 21)

CountryCityJob Ads
United KingdomLondon384
MalaysiaKuala Lumpur176
United StatesChicago82
GermanyDüsseldorf62
Japan東京45
SingaporeSingapore42
SwitzerlandDüsseldorf36
United KingdomBelfast26
Japan東京都16
IndiaMumbai15

Headquarters

Loading map...

Company Info

Legal Form: GmbH

Company Type: Private

Company Size: 1001 - 5000

Revenue: 50 - 100 million (USD)

Job Ad Metrics

Job Ads found: 966

Job Ads per Month: 20.1

Hiring Locations: 21

Data Info

Date of first job ad18.10.2019, 11:12
Date of last job ad27.05.2026, 13:47
Date merged01.06.2026, 02:21
Date created18.10.2019, 11:12

Sources: Aarp, Adzuna, Careerbuilder, Careerjet, Foundit, Glassdoor, Indeed, Jobrapido, Jora, Linkedin, Meinestadt, Monster, Monsterasia, Remoteok, Shine, Simplyhired, Stackshare, Techmap, Xing
 — Date merged: 01.06.2026, 02:21