Bahwan CyberTek

Bahwan CyberTek

Company

Legal NameBahwan CyberTek Inc
HeadquartersPittsburgh, United States
Websitehttps://bahwancybertek.com

About Bahwan CyberTek

Roles & Responsibilities Prior experience of independently pursuing large tenders and RFPs as well as building relationships to secure sole-sourced private deals is necessary. Exhaustive experience across the sales cycle mandatory: lead identification, prospecting, solution design, bid management, pricing, contract negotiation, delivery liaison, post-award monitoring, collections and client relationship management. Ability to grasp new technologies and understand and sell the company's niche IP product offerings will be key. Sales experience in BFSI domain and TIBCO products is required. Must have good experience in developing GTM strategy for new geos Should have handled large strategic clients in Singapore and ASEAN independently This role will carry a quarter-on-quarter sales target and direct responsibility (where the incumbent will have to support the sales head) for achieving numbers. The incumbent will report to the Asia Pacific business head and will also need to handle sales administration, continuously reviewing technology innovation on behalf of the practice, conducting client and technology market research. The role will include developing the country business pipeline (i.e. new opportunities in specific sectors and with target clients), working with pre-sales teams to design and develop client-specific solutions and following-up on sales opportunities. The incumbent will also need to handle key sectors and accounts, sales administration, market research and provide project delivery-related support. Being a client-focused role, excellent communication, networking and presentation ability is a must to uphold BCT’s reputation in front of new prospective clients and OEM vendors Must develop good relationship with OEM vendors such as TIBCO Good proposal development and presentation skills. As it is a lean team in Singapore, the candidate must be a hunter capable of finalizing deals independently. Though the role is based in SG, about 30% travel can be expected within ASEAN for business development purpose

Synonyms

bahwan cybertekbahwan cybertek incbahwan cybertek llcbahwan cybertek private limitedbahwan cybertek pte ltdbahwan cybertek pvt ltd

Technologies (from Job Ads)

sqljavajavascriptjiraoracle databasegitdevopsdebuggermysqllinuxpythondebuggingpostgresqlcheckstylehtmlawsspring frameworksoaphtml5jsonreact.jsreactosgithubxmlautoconfscalabilitycloud computingapache http serverapache licensescrumunit testingdockercoding conventionskubernetesnginxweb serverdocbookmicrosoft excelxbelangularjs

Hiring Locations (10 of 30)

CountryCityJob Ads
IndiaChennai619
IndiaMumbai199
IndiaBangalore96
United StatesNatick69
SingaporeSingapore62
IndiaIndia58
United StatesLos Angeles45
United StatesCambridge35
United StatesPittsburgh33
OmanMuscat31

Headquarters

Loading map...

Company Info

Legal Form: Inc

Company Type: Private

Company Size: 1001 - 5000

Revenue: 100 - 500 million (USD)

Job Ad Metrics

Job Ads found: 1469

Job Ads per Month: 30.0

Hiring Locations: 30

Data Info

Date of first job ad25.10.2019, 15:05
Date of last job ad11.05.2026, 14:52
Date merged19.05.2026, 23:42
Date created17.06.2019, 20:15

Sources: Aarp, Adzuna, Careerbuilder, Careerjet, Dice, FreeBase, Foundit, Glassdoor, Indeed, Jobrapido, Jora, Linkedin, Monster, Monsterasia, Naukri, Shine, Simplyhired, Snagajob, Techmap
 — Date merged: 19.05.2026, 23:42